Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSNK1A1L Peptide - middle region

CSNK1A1L Peptide - middle region

Product Specifications

Product Name Alternative

MGC33182, RP11-532O21.2, CK1

UniProt

Q8N752

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CSNK1A1L Rabbit Polyclonal Antibody (orb581842) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_660204

Preservative

Lyophilized powder

AA Sequence

TLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTQTGKQTEKNKNNVKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XAB2, ID (XAB2, HCNP, KIAA1177, SYF1, Pre-mRNA-splicing factor SYF1, Protein HCNP, XPA-binding protein 2) (Biotin) discontinued
043910-Biotin 200 µL

XAB2, ID (XAB2, HCNP, KIAA1177, SYF1, Pre-mRNA-splicing factor SYF1, Protein HCNP, XPA-binding protein 2) (Biotin) discontinued

Sign In for Pricing
View Details
GM2A sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
21975111 3x 1.0 µg

GM2A sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
RanBPM ShRNA Stable Knockout HeLa Cell Line
T6313 1x106 cells / 1.0 mL

RanBPM ShRNA Stable Knockout HeLa Cell Line

Sign In for Pricing
View Details
Rabbit anti-Bacillus thuringiensis subsp. morrisoni Pesticidal crystal protein cry1Fb polyclonal Antibody
MBS1490269-01 0.05 mg

Rabbit anti-Bacillus thuringiensis subsp. morrisoni Pesticidal crystal protein cry1Fb polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-Bacillus thuringiensis subsp. morrisoni Pesticidal crystal protein cry1Fb polyclonal Antibody
MBS1490269-02 0.1 mg

Rabbit anti-Bacillus thuringiensis subsp. morrisoni Pesticidal crystal protein cry1Fb polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-Bacillus thuringiensis subsp. morrisoni Pesticidal crystal protein cry1Fb polyclonal Antibody
MBS1490269-03 5x 0.1 mg

Rabbit anti-Bacillus thuringiensis subsp. morrisoni Pesticidal crystal protein cry1Fb polyclonal Antibody

Sign In for Pricing
View Details