CSNK1A1L Peptide - middle region
CSNK1A1L Peptide - middle region
Product Specifications
Product Name Alternative
MGC33182, RP11-532O21.2, CK1
UniProt
Q8N752
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CSNK1A1L Rabbit Polyclonal Antibody (orb581842) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_660204
Preservative
Lyophilized powder
AA Sequence
TLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTQTGKQTEKNKNNVKD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR10361685 96 Well
Chicken Alpha 1, 6 mannosyl glycoprotein 2 β N acetylglucosaminyltransferase (MGAT2) ELISA Kit
Sign In for Pricing
View Details 
MBS7075547-01 0.05 mg (E-Coli)
Recombinant Mytilus edulis APGW-amide-related neuropeptide
Sign In for Pricing
View Details MBS7075547-02 0.2 mg (E-Coli)
Recombinant Mytilus edulis APGW-amide-related neuropeptide
Sign In for Pricing
View Details MBS7075547-03 0.05 mg (Yeast)
Recombinant Mytilus edulis APGW-amide-related neuropeptide
Sign In for Pricing
View Details MBS7075547-04 0.5 mg (E-Coli)
Recombinant Mytilus edulis APGW-amide-related neuropeptide
Sign In for Pricing
View Details