Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSNK1G2 Peptide - middle region

CSNK1G2 Peptide - middle region

Product Specifications

Product Name Alternative

CK1g2

UniProt

P78368

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CSNK1G2 Rabbit Polyclonal Antibody (orb581509) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001310

Preservative

Lyophilized powder

AA Sequence

SKNQALNSTNGELNADDPTAGHSNAPITAPAEVEVADETKCCCFFKRRKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn1r30 Mouse Gene Knockout Kit (CRISPR)
KN519042 1 Kit

Vmn1r30 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Kv2.1 (KCNB1) Mouse Monoclonal Antibody [Clone ID: K39/25]
75-159 100 µL

Kv2.1 (KCNB1) Mouse Monoclonal Antibody [Clone ID: K39/25]

Sign In for Pricing
View Details
Frozen Tissue Blocks, Ovary: right
CB500858 1 Block

Frozen Tissue Blocks, Ovary: right

Sign In for Pricing
View Details
ZNF580 Rabbit Polyclonal Antibody
TA366131 100 µL

ZNF580 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZNF225 Human Gene Knockout Kit (CRISPR)
KN417392 1 Kit

ZNF225 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BC031181 Mouse Gene Knockout Kit (CRISPR)
KN502036 1 Kit

BC031181 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details