Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSNK1G2 Peptide - middle region

CSNK1G2 Peptide - middle region

Product Specifications

Product Name Alternative

CK1g2

UniProt

P78368

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CSNK1G2 Rabbit Polyclonal Antibody (orb581509) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001310

Preservative

Lyophilized powder

AA Sequence

SKNQALNSTNGELNADDPTAGHSNAPITAPAEVEVADETKCCCFFKRRKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant YY1 Monoclonal Antibody
E-AB-81623-01 50 µL

Recombinant YY1 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant YY1 Monoclonal Antibody
E-AB-81623-02 100 µL

Recombinant YY1 Monoclonal Antibody

Sign In for Pricing
View Details
OR4K14 Antibody
8G605-AAT 50 µg

OR4K14 Antibody

Sign In for Pricing
View Details
PPP1R8 Antibody
8C17084-AAT 50 µg

PPP1R8 Antibody

Sign In for Pricing
View Details
CD28 Mouse Monoclonal Antibody [Clone ID: CD28.2]
AM12006FC-N 100 Tests

CD28 Mouse Monoclonal Antibody [Clone ID: CD28.2]

Sign In for Pricing
View Details
Transketolase (TKT) (NM_001135055) Human Recombinant Protein
TP326037L 1 mg

Transketolase (TKT) (NM_001135055) Human Recombinant Protein

Sign In for Pricing
View Details