Csrp2 Peptide - middle region
Csrp2 Peptide - middle region
Product Specifications
Product Name Alternative
AW551867, Crp2, SmLim
UniProt
P97314
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Csrp2 Rabbit Polyclonal Antibody (orb575054) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_031818
Preservative
Lyophilized powder
AA Sequence
IKPESAQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIGAGKPW
More Discoveries
Explore Other Products
Browse additional items from our catalog
sc-434555-LAC-2 200 µL
Olfr1420 Lentiviral Activation Particles (m2)
Sign In for Pricing
View Details PB9509-Cy3 100 µg/Vial
Anti-SFRS3/SRSF3 Antibody Picoband® (Cy3 Conjugate)
Sign In for Pricing
View Details 
RC228912L3V 200 µL
TBXAS1 (NM_001166254) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 