Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Csrp2 Peptide - middle region

Csrp2 Peptide - middle region

Product Specifications

Product Name Alternative

AW551867, Crp2, SmLim

UniProt

P97314

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Csrp2 Rabbit Polyclonal Antibody (orb575054) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031818

Preservative

Lyophilized powder

AA Sequence

IKPESAQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIGAGKPW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Argininosuccinate Lyase (ASL) Rabbit Polyclonal Antibody
TA308495 100 µL

Argininosuccinate Lyase (ASL) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to IK Cytokine, Down Regulator Of HLA II (IK)
MBS2084678-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to IK Cytokine, Down Regulator Of HLA II (IK)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to IK Cytokine, Down Regulator Of HLA II (IK)
MBS2084678-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to IK Cytokine, Down Regulator Of HLA II (IK)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to IK Cytokine, Down Regulator Of HLA II (IK)
MBS2084678-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to IK Cytokine, Down Regulator Of HLA II (IK)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to IK Cytokine, Down Regulator Of HLA II (IK)
MBS2084678-04 1 mL

APC/CY7-Linked Polyclonal Antibody to IK Cytokine, Down Regulator Of HLA II (IK)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to IK Cytokine, Down Regulator Of HLA II (IK)
MBS2084678-05 5 mL

APC/CY7-Linked Polyclonal Antibody to IK Cytokine, Down Regulator Of HLA II (IK)

Sign In for Pricing
View Details