Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CST8 Peptide - N-terminal region

CST8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CRES

UniProt

O60676

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_005483

Preservative

Lyophilized powder

AA Sequence

LLEYLIDVEIARSDCRKPLSTNEICAIQENSKLKRKLSCSFLVGALPWNG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERPINB5 Antibody
OC-303-01 50 μL

SERPINB5 Antibody

Sign In for Pricing
View Details
SERPINB5 Antibody
OC-303-02 100 µL

SERPINB5 Antibody

Sign In for Pricing
View Details
SERPINB5 Antibody
OC-303-03 1 mL

SERPINB5 Antibody

Sign In for Pricing
View Details
GlcNac b-O-BSA Colloidal Gold Conjugate, 1mL 10nm
CCG-1013-10 1 mL

GlcNac b-O-BSA Colloidal Gold Conjugate, 1mL 10nm

Sign In for Pricing
View Details
MLH3 Rabbit Polyclonal Antibody
TA378557 100 µL

MLH3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
hemoglobin subunit gamma 1 (HBG1) (NM_000559) Human Over-expression Lysate
LC400190 20 µg

hemoglobin subunit gamma 1 (HBG1) (NM_000559) Human Over-expression Lysate

Sign In for Pricing
View Details