Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CST8 Peptide - N-terminal region

CST8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CRES

UniProt

O60676

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_005483

Preservative

Lyophilized powder

AA Sequence

LLEYLIDVEIARSDCRKPLSTNEICAIQENSKLKRKLSCSFLVGALPWNG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CRP/C-Reactive Protein
PKSH031180 200 µg

Recombinant Human CRP/C-Reactive Protein

Sign In for Pricing
View Details
OR2T12 (NM_001004692) Human Over-expression Lysate
LY423880 100 µg

OR2T12 (NM_001004692) Human Over-expression Lysate

Sign In for Pricing
View Details
Doxylamine N, N’-Dioxide
TRC-D562025-500MG 500 mg

Doxylamine N, N’-Dioxide

Sign In for Pricing
View Details
(S)-Viloxazine-d5 Hydrochloride
TRC-V312457-1MG 1 mg

(S)-Viloxazine-d5 Hydrochloride

Sign In for Pricing
View Details
Texas Red Conjugated Goat Affinity Purified Antibody to Mouse IgM
TAF-445-1 1 mL

Texas Red Conjugated Goat Affinity Purified Antibody to Mouse IgM

Sign In for Pricing
View Details
Human IgM Immunoglobulin (DA4-4), Biotin conjugate, 0.1mg/mL
BNCB0759-500 1x 500 µL

Human IgM Immunoglobulin (DA4-4), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details