Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CST9 Peptide - middle region

CST9 Peptide - middle region

Product Specifications

Product Name Alternative

CLM

UniProt

Q5W186

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001008693

Preservative

Lyophilized powder

AA Sequence

LRVLSSWREDSMDRKWRGKMVFSMNLQLRQTVCRKFEDDIDNCPFQESLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIF3A Antibody
C48166-01 50 μL

KIF3A Antibody

Sign In for Pricing
View Details
KIF3A Antibody
C48166-02 100 µL

KIF3A Antibody

Sign In for Pricing
View Details
Dmrtc1a Mouse siRNA Oligo Duplex (Locus ID 70887)
SR404442 1 Kit

Dmrtc1a Mouse siRNA Oligo Duplex (Locus ID 70887)

Sign In for Pricing
View Details
Cat Recombination Activating Gene 1 ELISA Kit
MBS100213 Inquire

Cat Recombination Activating Gene 1 ELISA Kit

Sign In for Pricing
View Details
BRLF1 Rabbit Polyclonal Antibody (Cy5.5)
orb1036660 100 µL

BRLF1 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
HUS1 Antibody
C44148-01 50 μL

HUS1 Antibody

Sign In for Pricing
View Details