Cstf2 Peptide - N-terminal region
Cstf2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
64kDa, C630034J23Rik, Cstf64
UniProt
Q8BIQ5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Cstf2 Rabbit Polyclonal Antibody (orb577545) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_573459
Preservative
Lyophilized powder
AA Sequence
MAGLPVRDPAVDRSLRSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
041252-Biotin 200 µL
Rps6ka2, NT (Rps6ka2, Mapkapk1c, Rsk3, Ribosomal protein S6 kinase alpha-2, 90kD ribosomal protein S6 kinase 2, MAP kinase-activated protein kinase 1c, Protein-tyrosine kinase Mpk-9, Ribosomal S6 kinase 3, pp90RSK3) (Biotin) discontinued
Sign In for Pricing
View Details 
K3765105 3x 1.0 µg
Phlpp1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
Sign In for Pricing
View Details abx117575 1 Pair (5x 96 Well)
Metallothionein-1G (MT1G) Antibody Pair
Sign In for Pricing
View Details