Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cstf2 Peptide - N-terminal region

Cstf2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

64kDa, C630034J23Rik, Cstf64

UniProt

Q8BIQ5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cstf2 Rabbit Polyclonal Antibody (orb577545) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_573459

Preservative

Lyophilized powder

AA Sequence

MAGLPVRDPAVDRSLRSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit for Defensin Alpha 5, Paneth Cell Specific (DEFa5)
TRV-0045269-01 24 Tests

ELISA Kit for Defensin Alpha 5, Paneth Cell Specific (DEFa5)

Sign In for Pricing
View Details
ELISA Kit for Defensin Alpha 5, Paneth Cell Specific (DEFa5)
TRV-0045269-02 48 Tests

ELISA Kit for Defensin Alpha 5, Paneth Cell Specific (DEFa5)

Sign In for Pricing
View Details
ELISA Kit for Defensin Alpha 5, Paneth Cell Specific (DEFa5)
TRV-0045269-03 96 Tests

ELISA Kit for Defensin Alpha 5, Paneth Cell Specific (DEFa5)

Sign In for Pricing
View Details
ELISA Kit for Defensin Alpha 5, Paneth Cell Specific (DEFa5)
TRV-0045269-04 5x 96 Tests

ELISA Kit for Defensin Alpha 5, Paneth Cell Specific (DEFa5)

Sign In for Pricing
View Details
ELISA Kit for Defensin Alpha 5, Paneth Cell Specific (DEFa5)
TRV-0045269-05 10x 96 Tests

ELISA Kit for Defensin Alpha 5, Paneth Cell Specific (DEFa5)

Sign In for Pricing
View Details
CASKIN1 CRISPRa sgRNA lentivector (set of three targets)(Human)
15059121 3x 1.0µg DNA

CASKIN1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details