Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTDSP2 Peptide - N-terminal region

CTDSP2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

OS4, PSR2, SCP2

UniProt

O14595

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CTDSP2 Rabbit Polyclonal Antibody (orb581568) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005721

Preservative

Lyophilized powder

AA Sequence

MEHGSIITQARREDALVLTKQGLVSKSSPKKPRGRNIFKALFCCFRAQHV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Factor VIII (F8) (NM_019863) Human Recombinant Protein
TP761167 50 µg

Factor VIII (F8) (NM_019863) Human Recombinant Protein

Sign In for Pricing
View Details
Human MASTL activation kit by CRISPRa
GA113776 1 Kit

Human MASTL activation kit by CRISPRa

Sign In for Pricing
View Details
Human FGD2 activation kit by CRISPRa
GA116621 1 Kit

Human FGD2 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS623217 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
OptiWell™ Deep Well Plates
D3096-45S 50 Units/Case

OptiWell™ Deep Well Plates

Sign In for Pricing
View Details
TPD52L2 (NM_001243894) Human Tagged ORF Clone
RG236093 10 µg

TPD52L2 (NM_001243894) Human Tagged ORF Clone

Sign In for Pricing
View Details