Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTDSP2 Peptide - N-terminal region

CTDSP2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

OS4, PSR2, SCP2

UniProt

O14595

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CTDSP2 Rabbit Polyclonal Antibody (orb581568) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005721

Preservative

Lyophilized powder

AA Sequence

MEHGSIITQARREDALVLTKQGLVSKSSPKKPRGRNIFKALFCCFRAQHV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calprotectin (S100A8) Rabbit Polyclonal Antibody
TA381219 100 µL

Calprotectin (S100A8) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PPP1R12C Human Gene Knockout Kit (CRISPR)
KN424096 1 Kit

PPP1R12C Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Drebrin 1 (DBN1) (DBN1/2879), CF405S conjugate, 0.1mg/mL
BNC042879-500 1x 500 µL

Drebrin 1 (DBN1) (DBN1/2879), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human ZNF586 activation kit by CRISPRa
GA110274 1 Kit

Human ZNF586 activation kit by CRISPRa

Sign In for Pricing
View Details
PHC2 Rabbit Polyclonal Antibody
TA379862 100 µL

PHC2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mini Sample Mouse CTSS (Cathepsin S) ELISA Kit
E-MSEL-M0025-01 24 Tests

Mini Sample Mouse CTSS (Cathepsin S) ELISA Kit

Sign In for Pricing
View Details