Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTDSP2 Peptide - middle region

CTDSP2 Peptide - middle region

Product Specifications

Product Name Alternative

OS4, PSR2, SCP2

UniProt

O14595

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CTDSP2 Rabbit Polyclonal Antibody (orb581569) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005721

Preservative

Lyophilized powder

AA Sequence

ASYIFHPENAVPVQSWFDDMADTELLNLIPIFEELSGAEDVYTSLGQLRA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD13 (Alanyl Aminopeptidase, Alanyl Membrane Aminopeptidase, Aminopeptidase M, gp150, Aminopeptidase N, ANPEP, APN, CD13 Antigen, hAPN, Lap 1, Lap1, Microsomal Aminopeptidase, Myeloid Plasma Membrane Glycoprotein CD13, p150, PEPN) (Biotin) discontinued
C2264-03H 500 µg

CD13 (Alanyl Aminopeptidase, Alanyl Membrane Aminopeptidase, Aminopeptidase M, gp150, Aminopeptidase N, ANPEP, APN, CD13 Antigen, hAPN, Lap 1, Lap1, Microsomal Aminopeptidase, Myeloid Plasma Membrane Glycoprotein CD13, p150, PEPN) (Biotin) discontinued

Sign In for Pricing
View Details
SPSB1 (SPRY Domain-containing SOCS Box Protein 1, SSB1, SSB-1) (MaxLight 550)
MBS6214180-01 0.1 mL

SPSB1 (SPRY Domain-containing SOCS Box Protein 1, SSB1, SSB-1) (MaxLight 550)

Sign In for Pricing
View Details
SPSB1 (SPRY Domain-containing SOCS Box Protein 1, SSB1, SSB-1) (MaxLight 550)
MBS6214180-02 5x 0.1 mL

SPSB1 (SPRY Domain-containing SOCS Box Protein 1, SSB1, SSB-1) (MaxLight 550)

Sign In for Pricing
View Details
Goose Total beta Amyloid Protein ELISA Kit
MBS030738 Inquire

Goose Total beta Amyloid Protein ELISA Kit

Sign In for Pricing
View Details
KTELC1 siRNA (m)
sc-146608 10 µM

KTELC1 siRNA (m)

Sign In for Pricing
View Details
PIG-X Rabbit Polyclonal Antibody
E28PT3726 100 µL

PIG-X Rabbit Polyclonal Antibody

Sign In for Pricing
View Details