Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTF1 Peptide - N-terminal region

CTF1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CT-1, CT1

UniProt

Q16619

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CTF1 Rabbit Polyclonal Antibody (orb581511) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001321

Preservative

Lyophilized powder

AA Sequence

HSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fc epsilon RI (FCER1A) (NM_002001) Human Over-expression Lysate
LY400730 100 µg

Fc epsilon RI (FCER1A) (NM_002001) Human Over-expression Lysate

Sign In for Pricing
View Details
Human LOC102723655 activation kit by CRISPRa
GA119542 1 Kit

Human LOC102723655 activation kit by CRISPRa

Sign In for Pricing
View Details
FZD5 Antibody
KC-17512-01 50 μL

FZD5 Antibody

Sign In for Pricing
View Details
FZD5 Antibody
KC-17512-02 100 µL

FZD5 Antibody

Sign In for Pricing
View Details
FZD5 Antibody
KC-17512-03 1 mL

FZD5 Antibody

Sign In for Pricing
View Details
DLST Recombinant Rabbit monoclonal Antibody
HA751337 100 µL

DLST Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details