Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTF1 Peptide - N-terminal region

CTF1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CT-1, CT1

UniProt

Q16619

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CTF1 Rabbit Polyclonal Antibody (orb581511) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001321

Preservative

Lyophilized powder

AA Sequence

HSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse IgG2b (Fcγ Fragment specific), AlpSdAbs® VHH
HA710254 100 µg

Mouse IgG2b (Fcγ Fragment specific), AlpSdAbs® VHH

Sign In for Pricing
View Details
CIBAR1 Antibody
KC-31494-01 50 μL

CIBAR1 Antibody

Sign In for Pricing
View Details
CIBAR1 Antibody
KC-31494-02 100 µL

CIBAR1 Antibody

Sign In for Pricing
View Details
CIBAR1 Antibody
KC-31494-03 1 mL

CIBAR1 Antibody

Sign In for Pricing
View Details
Human BHLHB5 (BHLHE22) activation kit by CRISPRa
GA109119 1 Kit

Human BHLHB5 (BHLHE22) activation kit by CRISPRa

Sign In for Pricing
View Details
Tnfrsf1a Mouse Gene Knockout Kit (CRISPR)
KN517983 1 Kit

Tnfrsf1a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details