Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTNND1 Peptide - middle region

CTNND1 Peptide - middle region

Product Specifications

Product Name Alternative

CAS, CTNND, KIAA0384, P120CAS, P120CTN, p120, p120 (CAS), p120 (CTN)

UniProt

O60716

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CTNND1 Rabbit Polyclonal Antibody (orb330649) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001078927

Preservative

Lyophilized powder

AA Sequence

QTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Corilagin discontinued
371304 5 mg

Corilagin discontinued

Sign In for Pricing
View Details
1-Propanesulfonyl chloride
abx182910-01 5 g

1-Propanesulfonyl chloride

Sign In for Pricing
View Details
1-Propanesulfonyl chloride
abx182910-02 25 g

1-Propanesulfonyl chloride

Sign In for Pricing
View Details
1-Propanesulfonyl chloride
abx182910-03 100 g

1-Propanesulfonyl chloride

Sign In for Pricing
View Details
1-Propanesulfonyl chloride
abx182910-04 500 g

1-Propanesulfonyl chloride

Sign In for Pricing
View Details
Mouse Mtmr6 (NM_144843) AAV Particle
MR209453A1V 250 µL

Mouse Mtmr6 (NM_144843) AAV Particle

Sign In for Pricing
View Details