Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ctsd Peptide - C-terminal region

Ctsd Peptide - C-terminal region

Product Specifications

Product Name Alternative

CD, CatD

UniProt

P18242

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ctsd Rabbit Polyclonal Antibody (orb578086) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034113

Preservative

Lyophilized powder

AA Sequence

KTICLSGFMGMDIPPPSGPLWILGDVFIGSYYTVFDRDNNRVGFANAVVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGEB18 Antibody
43745 100 µL

MAGEB18 Antibody

Sign In for Pricing
View Details
CaMKII/CaMKII beta Rabbit pAb
E2382213 100 µL

CaMKII/CaMKII beta Rabbit pAb

Sign In for Pricing
View Details
RNASEH (Ribonuclease H) Monkey ELISA Kit
G8409 96 Tests

RNASEH (Ribonuclease H) Monkey ELISA Kit

Sign In for Pricing
View Details
Phospho-CREB-1 (Ser133) Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-0036R-BF594-01 20 µL

Phospho-CREB-1 (Ser133) Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Phospho-CREB-1 (Ser133) Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-0036R-BF594-02 100 µL

Phospho-CREB-1 (Ser133) Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
ACAT1 Adenovirus (Rat)
11150056 1.0 mL

ACAT1 Adenovirus (Rat)

Sign In for Pricing
View Details