Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ctsd Peptide - C-terminal region

Ctsd Peptide - C-terminal region

Product Specifications

Product Name Alternative

CD, CatD

UniProt

P18242

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ctsd Rabbit Polyclonal Antibody (orb578086) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034113

Preservative

Lyophilized powder

AA Sequence

KTICLSGFMGMDIPPPSGPLWILGDVFIGSYYTVFDRDNNRVGFANAVVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE Anti-human CD40 Antibody *HI40a*
104001L1-AAT 100 Tests

PE Anti-human CD40 Antibody *HI40a*

Sign In for Pricing
View Details
Monkey MPIF-1 ELISA Kit
EMKM0342 96 Tests

Monkey MPIF-1 ELISA Kit

Sign In for Pricing
View Details
RBM18 Protein Vector (Rat) (pPB-C-His)
PV298414 500 ng

RBM18 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Human/Mouse/Rat Activin A Protein
MBS9719437-01 0.02 mg

Human/Mouse/Rat Activin A Protein

Sign In for Pricing
View Details
Human/Mouse/Rat Activin A Protein
MBS9719437-02 0.1 mg

Human/Mouse/Rat Activin A Protein

Sign In for Pricing
View Details
Human/Mouse/Rat Activin A Protein
MBS9719437-03 0.5 mg

Human/Mouse/Rat Activin A Protein

Sign In for Pricing
View Details