Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTSE Peptide - N-terminal region

CTSE Peptide - N-terminal region

Product Specifications

Product Name Alternative

CATE

UniProt

P14091

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CTSE Rabbit Polyclonal Antibody (orb584577) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_683865

Preservative

Lyophilized powder

AA Sequence

SLKKKLRARSQLSEFWKSHNLDMIQFTESCSMDQSAKEPLINYLDMEYFG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Benralizumab Biosimilar - Research Grade
ICH5313-1mg 1 mg

Benralizumab Biosimilar - Research Grade

Sign In for Pricing
View Details
Anti-SNX31 Antibody Picoband®, APC Conjugate
A14470-1-APC 100 µg/Vial

Anti-SNX31 Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details
Atp1b3 sgRNA CRISPR Lentivector set (Mouse)
K4781301 3x 1.0 µg

Atp1b3 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Lentiviral mouse Cyp11b2 shRNA (UAS) - Lentiviral mouse Cyp11b2 shRNA (UAS, RFP) plasmid
GTR15177817 1 Vial

Lentiviral mouse Cyp11b2 shRNA (UAS) - Lentiviral mouse Cyp11b2 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
DRG2 (m) -PR
sc-143171-PR 10 µM - 20 µL

DRG2 (m) -PR

Sign In for Pricing
View Details
(7-(4-{4-[4-(2,3-Dichlorophenyl)piperazin-1-yl]butoxy}butoxy)-3,4-dihydroquinolin-2(1H)-one)
TRC-D436125-100MG 100 mg

(7-(4-{4-[4-(2,3-Dichlorophenyl)piperazin-1-yl]butoxy}butoxy)-3,4-dihydroquinolin-2(1H)-one)

Sign In for Pricing
View Details