Ctsz Peptide - N-terminal region
Ctsz Peptide - N-terminal region
Product Specifications
Product Name Alternative
AI787083, AU019819, CTSX, D2Wsu143e
UniProt
Q9NVH1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Ctsz Rabbit Polyclonal Antibody (orb579386) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_808524
Preservative
Lyophilized powder
AA Sequence
SAARARLYFRSGQTCYHPIRGDQLALLGRRTYPRPHEYLSPADLPKNWDW
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040204-100 1x 100 µL
Complement C4d (C4D204), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040026-100 1x 100 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940149-500 1x 500 µL
CD106 / VCAM1 (1.4C3), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881429-100 1x 100 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402848-100 1x 100 µL
Fibronectin (Fn-3), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details