Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CUL3 Peptide - C-terminal region

CUL3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CUL-3, PHA2E

UniProt

Q13618

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CUL3 Rabbit Polyclonal Antibody (orb584955) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_003581

Preservative

Lyophilized powder

AA Sequence

QETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIENGHIFTVNDQFTS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal BLOC1S2 Antibody [CoraFluor 1]
NBP3-00218CL1 0.1 mL

Rabbit Polyclonal BLOC1S2 Antibody [CoraFluor 1]

Sign In for Pricing
View Details
Lentiviral mouse Reln shRNA (UAS) - Lentiviral mouse Reln shRNA (UAS, RFP) (25)
GTR15214295 1 Vial

Lentiviral mouse Reln shRNA (UAS) - Lentiviral mouse Reln shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Phospho-PPP1R2 (S44) Antibody
MBS7120204-01 0.05 mg

Phospho-PPP1R2 (S44) Antibody

Sign In for Pricing
View Details
Phospho-PPP1R2 (S44) Antibody
MBS7120204-02 0.1 mg

Phospho-PPP1R2 (S44) Antibody

Sign In for Pricing
View Details
Phospho-PPP1R2 (S44) Antibody
MBS7120204-03 5x 0.1 mg

Phospho-PPP1R2 (S44) Antibody

Sign In for Pricing
View Details
Human EML3 knockout cell line
ABC-KH4763 1 Vial

Human EML3 knockout cell line

Sign In for Pricing
View Details