Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CUTA Peptide - middle region

CUTA Peptide - middle region

Product Specifications

Product Name Alternative

ACHAP, C6orf82, MGC111154

UniProt

O60888

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CUTA Rabbit Polyclonal Antibody (orb579246) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001014840

Preservative

Lyophilized powder

AA Sequence

AFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Ret Antibody (009) [Alexa Fluor 488]
NBP2-90038AF488 0.1 mL

Rabbit Monoclonal Ret Antibody (009) [Alexa Fluor 488]

Sign In for Pricing
View Details
SLC2A4RG (NM_020062) Human Over-expression Lysate
LS056731-100ug 100 µg

SLC2A4RG (NM_020062) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-DLK Antibody
CQA5008-01 30 µL

Anti-DLK Antibody

Sign In for Pricing
View Details
Anti-DLK Antibody
CQA5008-02 50 μL

Anti-DLK Antibody

Sign In for Pricing
View Details
Anti-DLK Antibody
CQA5008-03 100 µL

Anti-DLK Antibody

Sign In for Pricing
View Details
Anti-DLK Antibody
CQA5008-04 200 µL

Anti-DLK Antibody

Sign In for Pricing
View Details