CXorf9 Peptide - C-terminal region
CXorf9 Peptide - C-terminal region
Product Specifications
Product Name Alternative
753P9, CXorf9, HACS2, SH3D6C, SLY
UniProt
O75995
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CXorf9 Rabbit Polyclonal Antibody (orb326186) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_061863
Preservative
Lyophilized powder
AA Sequence
RPSRRQSKGKRPKPKTLHELLERIGLEEHTSTLLLNGYQTLEDFKELRET
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470630-500 1x 500 µL
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680225-500 1x 500 µL
Major Vault Protein (MVP) (1032), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400856-100 1x 100 µL
WT1 (Wilm's Tumor 1) (6F-H2), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details