Cyb5r1 Peptide - N-terminal region
Cyb5r1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
1500005G05Rik, B5R.1, C80155, Nqo3a2
UniProt
Q9DB73
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Cyb5r1 Rabbit Polyclonal Antibody (orb579996) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_082333
Preservative
Lyophilized powder
AA Sequence
LVIRPYTPVTSDEDQGYVDLVIKVYLKGVHPKFPEGGKMSQYLDSLKIGD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940460-100 1x 100 µL
CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740270-500 1x 500 µL
Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040012-100 1x 100 µL
Tyrosinase (T311), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681820-100 1x 100 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740034-100 1x 100 µL
Cytokeratin 8/18 (C-51), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040775-500 1x 500 µL
Pgp9.5 (UCHL-1) (UCHL1/775), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details