Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cyb5r2 Peptide - C-terminal region

Cyb5r2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RGD1308421

UniProt

Q6AY12

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cyb5r2 Rabbit Polyclonal Antibody (orb582190) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001014266

Preservative

Lyophilized powder

AA Sequence

WEYSSGFITADMIKEHLPPPGEATLILVCGPPPLIQEAAHPSLEQLGYTK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEF2B Antibody
E19-3236 100 µg -100 µL

MEF2B Antibody

Sign In for Pricing
View Details
Recombinant Human TACI(TNFRSF13B)
HEOPP-2013 5 µg

Recombinant Human TACI(TNFRSF13B)

Sign In for Pricing
View Details
Diazinon Impurity 3
RM-D011403-01 10 mg

Diazinon Impurity 3

Sign In for Pricing
View Details
Diazinon Impurity 3
RM-D011403-02 25 mg

Diazinon Impurity 3

Sign In for Pricing
View Details
Diazinon Impurity 3
RM-D011403-03 50 mg

Diazinon Impurity 3

Sign In for Pricing
View Details
Diazinon Impurity 3
RM-D011403-04 100 mg

Diazinon Impurity 3

Sign In for Pricing
View Details