Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cyb5r2 Peptide - C-terminal region

Cyb5r2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RGD1308421

UniProt

Q6AY12

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cyb5r2 Rabbit Polyclonal Antibody (orb582190) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001014266

Preservative

Lyophilized powder

AA Sequence

WEYSSGFITADMIKEHLPPPGEATLILVCGPPPLIQEAAHPSLEQLGYTK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL36AP38 CRISPR All-in-one AAV vector set (with saCas9)(Human)
41565151 3x 1.0 µg DNA

RPL36AP38 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
VPS13A-set siRNA/shRNA/RNAi Lentivector (Human)
50168091 4x 500 ng

VPS13A-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
EREG Antibody
MBS9434858-01 0.1 mL

EREG Antibody

Sign In for Pricing
View Details
EREG Antibody
MBS9434858-02 5x 0.1 mL

EREG Antibody

Sign In for Pricing
View Details
Goat Aflatoxin B1 aldehyde reductase member 3 (AKR7A3) ELISA kit
GTR10406953 96 Well

Goat Aflatoxin B1 aldehyde reductase member 3 (AKR7A3) ELISA kit

Sign In for Pricing
View Details
Human Myeloperoxidase antineutrophil cytoplasmic antibody (IgG) ELISA Kit
MBS723395-01 48 Well

Human Myeloperoxidase antineutrophil cytoplasmic antibody (IgG) ELISA Kit

Sign In for Pricing
View Details