Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cyhr1 Peptide - middle region

Cyhr1 Peptide - middle region

Product Specifications

Product Name Alternative

1110031M01Rik, AU042374, Chrp

UniProt

Q9QXA1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cyhr1 Rabbit Polyclonal Antibody (orb55665) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_851293

Preservative

Lyophilized powder

AA Sequence

LAPGPSTHEDCLAGAWVATVIGLPLLAFDFHWVNGDRSSANLLLGGGMVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF599 Polyclonal Antibody, APC Conjugated
bs-19530R-APC 100 µL

ZNF599 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
LIX1, CT (LIX1, C5orf11, Protein limb expression 1 homolog) (MaxLight 490)
MBS6316488-01 0.1 mL

LIX1, CT (LIX1, C5orf11, Protein limb expression 1 homolog) (MaxLight 490)

Sign In for Pricing
View Details
LIX1, CT (LIX1, C5orf11, Protein limb expression 1 homolog) (MaxLight 490)
MBS6316488-02 5x 0.1 mL

LIX1, CT (LIX1, C5orf11, Protein limb expression 1 homolog) (MaxLight 490)

Sign In for Pricing
View Details
ALB (AL-01)
sc-51515 100 µg/mL

ALB (AL-01)

Sign In for Pricing
View Details
ANKRD1 Antibody - middle region
ARP77286_P050-25UL 25 µL

ANKRD1 Antibody - middle region

Sign In for Pricing
View Details
PLA2G5 antibody - middle region
MBS3205839-01 0.1 mL

PLA2G5 antibody - middle region

Sign In for Pricing
View Details