Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cyhr1 Peptide - middle region

Cyhr1 Peptide - middle region

Product Specifications

Product Name Alternative

1110031M01Rik, AU042374, Chrp

UniProt

Q9QXA1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cyhr1 Rabbit Polyclonal Antibody (orb55665) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_851293

Preservative

Lyophilized powder

AA Sequence

LAPGPSTHEDCLAGAWVATVIGLPLLAFDFHWVNGDRSSANLLLGGGMVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPS4B Polyclonal Antibody
MBS2573964-01 0.06 mL

VPS4B Polyclonal Antibody

Sign In for Pricing
View Details
VPS4B Polyclonal Antibody
MBS2573964-02 0.12 mL

VPS4B Polyclonal Antibody

Sign In for Pricing
View Details
VPS4B Polyclonal Antibody
MBS2573964-03 0.2 mL

VPS4B Polyclonal Antibody

Sign In for Pricing
View Details
VPS4B Polyclonal Antibody
MBS2573964-04 5x 0.2 mL

VPS4B Polyclonal Antibody

Sign In for Pricing
View Details
Goat Beta-Taxilin ELISA Kit
MBS7258493-01 48 Well

Goat Beta-Taxilin ELISA Kit

Sign In for Pricing
View Details
Goat Beta-Taxilin ELISA Kit
MBS7258493-02 96 Well

Goat Beta-Taxilin ELISA Kit

Sign In for Pricing
View Details