Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP11B1 Peptide - middle region

CYP11B1 Peptide - middle region

Product Specifications

Product Name Alternative

CPN1, CYP11B, DKFZp686B05283, FHI, FLJ36771, P450C11

UniProt

P15538

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CYP11B1 Rabbit Polyclonal Antibody (orb584586) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000488

Preservative

Lyophilized powder

AA Sequence

LALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PP1 2mg
A12724-2 2 mg

PP1 2mg

Sign In for Pricing
View Details
Chicken HK2 ELISA Kit
ECKH1256 96 Tests

Chicken HK2 ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal PDE1B Antibody [DyLight 594]
NBP2-97975DL594 0.1 mL

Rabbit Polyclonal PDE1B Antibody [DyLight 594]

Sign In for Pricing
View Details
NME4 Recombinant Protein (Rat)
RP214106 100 µg

NME4 Recombinant Protein (Rat)

Sign In for Pricing
View Details
MIR421 Rat MicroRNA Expression Plasmid (MI0001423)
SC403398 10 µg

MIR421 Rat MicroRNA Expression Plasmid (MI0001423)

Sign In for Pricing
View Details
N-Cyclohexyl 3-boronobenzenesulfonamide
sc-295686A 1 g

N-Cyclohexyl 3-boronobenzenesulfonamide

Sign In for Pricing
View Details