Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP11B1 Peptide - middle region

CYP11B1 Peptide - middle region

Product Specifications

Product Name Alternative

CPN1, CYP11B, DKFZp686B05283, FHI, FLJ36771, P450C11

UniProt

P15538

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CYP11B1 Rabbit Polyclonal Antibody (orb584586) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000488

Preservative

Lyophilized powder

AA Sequence

LALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CRISPR-Cpf1 Antibody (2D5-6G11) [Janelia Fluor 549]
NBP2-78819JF549 0.1 mL

Mouse Monoclonal CRISPR-Cpf1 Antibody (2D5-6G11) [Janelia Fluor 549]

Sign In for Pricing
View Details
CRP Antibody
OAMA01327-1MG 1 mg

CRP Antibody

Sign In for Pricing
View Details
Protease Activated Receptor 2 (PAR2) Polyclonal Antibody
CAU32019-01 100 µL

Protease Activated Receptor 2 (PAR2) Polyclonal Antibody

Sign In for Pricing
View Details
Protease Activated Receptor 2 (PAR2) Polyclonal Antibody
CAU32019-02 200 µL

Protease Activated Receptor 2 (PAR2) Polyclonal Antibody

Sign In for Pricing
View Details
Protease Activated Receptor 2 (PAR2) Polyclonal Antibody
CAU32019-03 1 mL

Protease Activated Receptor 2 (PAR2) Polyclonal Antibody

Sign In for Pricing
View Details
Anti-SFPQ Antibody
CQA2361-01 30 µL

Anti-SFPQ Antibody

Sign In for Pricing
View Details