CYP24A1 Peptide - C-terminal region
CYP24A1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
CP24, CYP24, MGC126273, MGC126274, P450-CC24, HCAI
UniProt
Q07973
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CYP24A1 Rabbit Polyclonal Antibody (orb584589) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_000773
Preservative
Lyophilized powder
AA Sequence
LNTKVWQDHTLAWDTIFKSVKACIDNRLEKYSQQPSADFLCDIYHQNRLS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC550525-100 1x 100 µL
CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740304-100 1x 100 µL
CD106 / VCAM1 (B-K9), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402040-100 1x 100 µL
ACTH (Adrenocorticotrophic Hormone) (Pituitary Marker) (CLIP/2040R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741424-500 1x 500 µL
Caldesmon, HMW (h-Caldesmon) (Smooth Muscle Marker) (CALD1/1424R), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details