Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP26B1 Peptide - middle region

CYP26B1 Peptide - middle region

Product Specifications

Product Name Alternative

CYP26A2, DKFZp686G0638, MGC129613, P450RAI-2

UniProt

Q9NR63

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CYP26B1 Rabbit Polyclonal Antibody (orb330921) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_063938

Preservative

Lyophilized powder

AA Sequence

SRFELATRTFPRITLVPVLHPVDGLSVKFFGLDSNQNEILPETEAMLSAT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Oleoyllinoleoylolein-d5
TRC-O019284-25MG 25 mg

Oleoyllinoleoylolein-d5

Sign In for Pricing
View Details
Trappc3 (NM_013718) Mouse Tagged ORF Clone
MG201614 10 µg

Trappc3 (NM_013718) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Prohibitin (Mitochondrial Marker) (PHB/3225), Biotin conjugate, 0.1mg/mL
BNCB3225-100 1x 100 µL

Prohibitin (Mitochondrial Marker) (PHB/3225), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GABRA6 Rabbit Polyclonal Antibody
HA500473 100 µL

GABRA6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Hivep3 activation kit by CRISPRa
GA202363 1 Kit

Mouse Hivep3 activation kit by CRISPRa

Sign In for Pricing
View Details
SLC26A6 Goat Polyclonal Antibody
AP32055PU-N 100 µg

SLC26A6 Goat Polyclonal Antibody

Sign In for Pricing
View Details