Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP26B1 Peptide - middle region

CYP26B1 Peptide - middle region

Product Specifications

Product Name Alternative

CYP26A2, DKFZp686G0638, MGC129613, P450RAI-2

UniProt

Q9NR63

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CYP26B1 Rabbit Polyclonal Antibody (orb330921) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_063938

Preservative

Lyophilized powder

AA Sequence

SRFELATRTFPRITLVPVLHPVDGLSVKFFGLDSNQNEILPETEAMLSAT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Fzd8 activation kit by CRISPRa
GA201499 1 Kit

Mouse Fzd8 activation kit by CRISPRa

Sign In for Pricing
View Details
CD66 (CEA) (COL-1 + CEA31 + C66/261), CF568 conjugate, 0.1mg/mL
BNC680747-500 1x 500 µL

CD66 (CEA) (COL-1 + CEA31 + C66/261), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Liver Canuliculi (HSA98), CF488A conjugate, 0.1mg/mL
BNC880098-100 1x 100 µL

Liver Canuliculi (HSA98), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MPP4 Human Gene Knockout Kit (CRISPR)
KN419980 1 Kit

MPP4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TCTP (TPT1) Rabbit Polyclonal Antibody
AP06666PU-N 100 µg

TCTP (TPT1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C10orf92 (CFAP46) Human Gene Knockout Kit (CRISPR)
KN435394 1 Kit

C10orf92 (CFAP46) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details