Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP2U1 Peptide - middle region

CYP2U1 Peptide - middle region

Product Specifications

Product Name Alternative

P450TEC

UniProt

Q7Z449

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CYP2U1 Rabbit Polyclonal Antibody (orb585162) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_898898

Preservative

Lyophilized powder

AA Sequence

VNICPWLYYLPFGPFKELRQIEKDITSFLKKIIKDHQESLDRENPQDFID

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nance-Horan Syndrome Protein Rabbit Polyclonal Antibody (PE)
orb489286 100 µL

Nance-Horan Syndrome Protein Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Locked Analog Bases (LNA-N) 50 nmol scale
26-6517N-05 1 Each

Locked Analog Bases (LNA-N) 50 nmol scale

Sign In for Pricing
View Details
Lentiviral human POC1B sgRNA gene knockout kit - Lentiviral human POC1B sgRNA gene knockout kit (25)
GTR15388299 1 Vial

Lentiviral human POC1B sgRNA gene knockout kit - Lentiviral human POC1B sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Fzd5 ORF Vector (Mouse) (pORF)
21112015 1.0 µg DNA

Fzd5 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
MAGED2 Rabbit pAb
E47R18625 100 µL

MAGED2 Rabbit pAb

Sign In for Pricing
View Details
Recombinant Nucleophosmin Antibody / NPM1
orb639834-01 20 µg

Recombinant Nucleophosmin Antibody / NPM1

Sign In for Pricing
View Details