Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP2U1 Peptide - middle region

CYP2U1 Peptide - middle region

Product Specifications

Product Name Alternative

P450TEC

UniProt

Q7Z449

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CYP2U1 Rabbit Polyclonal Antibody (orb585162) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_898898

Preservative

Lyophilized powder

AA Sequence

VNICPWLYYLPFGPFKELRQIEKDITSFLKKIIKDHQESLDRENPQDFID

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

11-chlorobenzo[e]acephenanthrylene
JH919352 1 Each

11-chlorobenzo[e]acephenanthrylene

Sign In for Pricing
View Details
FAM90A5P (NM_001164455) Human Over-expression Lysate
E45H01014-2 20 µg

FAM90A5P (NM_001164455) Human Over-expression Lysate

Sign In for Pricing
View Details
DAP3 Recombinant Protein (Mouse)
RP127832 100 µg

DAP3 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Rabbit Polyclonal OR10V1 Antibody
NBP2-32514-25ul 25 µL

Rabbit Polyclonal OR10V1 Antibody

Sign In for Pricing
View Details
Nucleic Acid Release Kit, Viral, BioAssayTM discontinued
N6927-50 1 Kit

Nucleic Acid Release Kit, Viral, BioAssayTM discontinued

Sign In for Pricing
View Details
L-Glutathione, Reduced
G-155-25-250g 250 g

L-Glutathione, Reduced

Sign In for Pricing
View Details