Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP8B1 Peptide - middle region

CYP8B1 Peptide - middle region

Product Specifications

Product Name Alternative

CP8B, CYP12, FLJ17826

UniProt

Q9UNU6

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CYP8B1 Rabbit Polyclonal Antibody (orb584584) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004382

Preservative

Lyophilized powder

AA Sequence

SLLWPREWLEVGRLQRLFHKMLSVSHSQEKEGISNWLGNMLQFLREQGVP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Jagged 1 Antibody
RC-15447-01 50 μL

Recombinant Jagged 1 Antibody

Sign In for Pricing
View Details
Recombinant Jagged 1 Antibody
RC-15447-02 100 µL

Recombinant Jagged 1 Antibody

Sign In for Pricing
View Details
Recombinant Jagged 1 Antibody
RC-15447-03 1 mL

Recombinant Jagged 1 Antibody

Sign In for Pricing
View Details
Human C9orf95 (NMRK1) activation kit by CRISPRa
GA110425 1 Kit

Human C9orf95 (NMRK1) activation kit by CRISPRa

Sign In for Pricing
View Details
Actr1a Mouse Gene Knockout Kit (CRISPR)
KN500789 1 Kit

Actr1a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ARHGEF9 Human Gene Knockout Kit (CRISPR)
KN416681 1 Kit

ARHGEF9 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details