Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

D9Ertd402e Peptide - N-terminal region

D9Ertd402e Peptide - N-terminal region

Product Specifications

Product Name Alternative

Gm1129, MGC91156, TOAG-1, D9Ertd402e

UniProt

Q66JZ4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with D9Ertd402e Rabbit Polyclonal Antibody (orb325920) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001013423

Preservative

Lyophilized powder

AA Sequence

MLGSWRAYSEMFCHLRPLRRFGLRKVLPHWLHYSRALSGAEAINALRPFY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

20b-Dihydrocortisol 21-Acetate
TRC-D448746-250MG 250 mg

20b-Dihydrocortisol 21-Acetate

Sign In for Pricing
View Details
CREBBP Rabbit Polyclonal Antibody
HA500191 100 µL

CREBBP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Ntn1 activation kit by CRISPRa
GA202984 1 Kit

Mouse Ntn1 activation kit by CRISPRa

Sign In for Pricing
View Details
CD95 / FAS / TNFRSF6 (FAS/3112), CF740 conjugate, 0.1mg/mL
BNC743112-100 1x 100 µL

CD95 / FAS / TNFRSF6 (FAS/3112), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human GAB4 activation kit by CRISPRa
GA115070 1 Kit

Human GAB4 activation kit by CRISPRa

Sign In for Pricing
View Details
5-Androsten-3,17-dione
TRC-A637563-10MG 10 mg

5-Androsten-3,17-dione

Sign In for Pricing
View Details