Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

D9Ertd402e Peptide - N-terminal region

D9Ertd402e Peptide - N-terminal region

Product Specifications

Product Name Alternative

Gm1129, MGC91156, TOAG-1, D9Ertd402e

UniProt

Q66JZ4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with D9Ertd402e Rabbit Polyclonal Antibody (orb325920) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001013423

Preservative

Lyophilized powder

AA Sequence

MLGSWRAYSEMFCHLRPLRRFGLRKVLPHWLHYSRALSGAEAINALRPFY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MNS1 Mouse Monoclonal Antibody [Clone ID: OTI1F2]
CF810386 100 µg

MNS1 Mouse Monoclonal Antibody [Clone ID: OTI1F2]

Sign In for Pricing
View Details
Salivary alpha amylase (AMY1C) (NM_001008219) Human Over-expression Lysate
LY423396 100 µg

Salivary alpha amylase (AMY1C) (NM_001008219) Human Over-expression Lysate

Sign In for Pricing
View Details
Phospho-GATA3 (S308) Recombinant Rabbit Monoclonal Antibody [ST44-09]
ET1609-17 100 µL

Phospho-GATA3 (S308) Recombinant Rabbit Monoclonal Antibody [ST44-09]

Sign In for Pricing
View Details
N-Boc-piperazine-d8
TRC-B662002-500MG 500 mg

N-Boc-piperazine-d8

Sign In for Pricing
View Details
Human CMYA5 activation kit by CRISPRa
GA116419 1 Kit

Human CMYA5 activation kit by CRISPRa

Sign In for Pricing
View Details
CD40L Antibody
KC-1004-01 50 μL

CD40L Antibody

Sign In for Pricing
View Details