Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dag1 Peptide - C-terminal region

Dag1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

D9Wsu13e, DG, Dp427, Dp71

UniProt

Q62165

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dag1 Rabbit Polyclonal Antibody (orb330487) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034147

Preservative

Lyophilized powder

AA Sequence

PPSPGSSAAPATEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tenomodulin (TNMD) Antibody
abx026953-01 80 µL

Tenomodulin (TNMD) Antibody

Sign In for Pricing
View Details
Tenomodulin (TNMD) Antibody
abx026953-02 400 µL

Tenomodulin (TNMD) Antibody

Sign In for Pricing
View Details
Human RBMXL1 siRNA
abx931105-01 15 nmol

Human RBMXL1 siRNA

Sign In for Pricing
View Details
Human RBMXL1 siRNA
abx931105-02 30 nmol

Human RBMXL1 siRNA

Sign In for Pricing
View Details
PRAF2 Rabbit pAb
E45R29374N-50 50 µL

PRAF2 Rabbit pAb

Sign In for Pricing
View Details
NCAPH2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV712656 1.0 µg DNA

NCAPH2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details