DAP Peptide - middle region
DAP Peptide - middle region
Product Specifications
Product Name Alternative
MGC99796
UniProt
P51397
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DAP Rabbit Polyclonal Antibody (orb584593) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_004385
Preservative
Lyophilized powder
AA Sequence
PSPPKPTVFISGVIARGDKDFPPAAAQVAHQKPHASMDKHPSPRTQHIQQ
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1293014-01 0.02 mg (E-Coli)
Recombinant Drosophila melanogaster UPF0551 protein CG15738 homolog, mitochondrial (CG15738)
Sign In for Pricing
View Details MBS1293014-02 0.02 mg (Yeast)
Recombinant Drosophila melanogaster UPF0551 protein CG15738 homolog, mitochondrial (CG15738)
Sign In for Pricing
View Details MBS1293014-03 0.1 mg (E-Coli)
Recombinant Drosophila melanogaster UPF0551 protein CG15738 homolog, mitochondrial (CG15738)
Sign In for Pricing
View Details MBS1293014-04 0.1 mg (Yeast)
Recombinant Drosophila melanogaster UPF0551 protein CG15738 homolog, mitochondrial (CG15738)
Sign In for Pricing
View Details MBS1293014-05 0.02 mg (Baculovirus)
Recombinant Drosophila melanogaster UPF0551 protein CG15738 homolog, mitochondrial (CG15738)
Sign In for Pricing
View Details MBS1293014-06 0.02 mg (Mammalian-Cell)
Recombinant Drosophila melanogaster UPF0551 protein CG15738 homolog, mitochondrial (CG15738)
Sign In for Pricing
View Details