DAPP1 Peptide - middle region
DAPP1 Peptide - middle region
Product Specifications
Product Name Alternative
BAM32, DKFZp667E0716
UniProt
Q9UN19
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DAPP1 Rabbit Polyclonal Antibody (orb330794) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_055210
Preservative
Lyophilized powder
AA Sequence
SLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETG
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR10377364 96 Well
Mouse Coiled coil domain containing protein 113 (CCDC113) ELISA kit
Sign In for Pricing
View Details 
053968-01 10 µg
Regulated On Activation In Normal T-Cell Expressed And Secreted (RANTES), Recombinant, Porcine, His-Tag
Sign In for Pricing
View Details 053968-02 50 µg
Regulated On Activation In Normal T-Cell Expressed And Secreted (RANTES), Recombinant, Porcine, His-Tag
Sign In for Pricing
View Details 053968-03 100 µg
Regulated On Activation In Normal T-Cell Expressed And Secreted (RANTES), Recombinant, Porcine, His-Tag
Sign In for Pricing
View Details