DAPP1 Peptide - middle region
DAPP1 Peptide - middle region
Product Specifications
Product Name Alternative
BAM32, DKFZp667E0716
UniProt
Q9UN19
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DAPP1 Rabbit Polyclonal Antibody (orb330794) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_055210
Preservative
Lyophilized powder
AA Sequence
SLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETG
More Discoveries
Explore Other Products
Browse additional items from our catalog
AMM03694G 0.1mg
Monoclonal ISGF3G Antibody (monoclonal) (M01), Clone: 1C10
Sign In for Pricing
View Details 
MBS520715-01 0.1 mg
Anti-Human Complement Factor B/Bb, Biotin (clone: M13/12), (Mouse IgG1 K)
Sign In for Pricing
View Details 
MBS520715-02 5x 0.1 mg
Anti-Human Complement Factor B/Bb, Biotin (clone: M13/12), (Mouse IgG1 K)
Sign In for Pricing
View Details