Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DBP Peptide - C-terminal region

DBP Peptide - C-terminal region

Product Specifications

Product Name Alternative

DABP

UniProt

Q10586

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DBP Rabbit Polyclonal Antibody (orb583801) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001343

Preservative

Lyophilized powder

AA Sequence

FSEEELKPQPIMKKARKIQVPEEQKDEKYWSRRYKNNEAAKRSRDARRLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pyridostatin (TFA)
HY-15176B-01 5 mg

Pyridostatin (TFA)

Sign In for Pricing
View Details
Pyridostatin (TFA)
HY-15176B-02 10 mg

Pyridostatin (TFA)

Sign In for Pricing
View Details
Pyridostatin (TFA)
HY-15176B-03 25 mg

Pyridostatin (TFA)

Sign In for Pricing
View Details
Pyridostatin (TFA)
HY-15176B-04 50 mg

Pyridostatin (TFA)

Sign In for Pricing
View Details
Pyridostatin (TFA)
HY-15176B-05 100 mg

Pyridostatin (TFA)

Sign In for Pricing
View Details
FBXO3 (NM_033406) Human Tagged ORF Clone
RC213872 10 µg

FBXO3 (NM_033406) Human Tagged ORF Clone

Sign In for Pricing
View Details