Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DBP Peptide - C-terminal region

DBP Peptide - C-terminal region

Product Specifications

Product Name Alternative

DABP

UniProt

Q10586

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DBP Rabbit Polyclonal Antibody (orb583801) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001343

Preservative

Lyophilized powder

AA Sequence

FSEEELKPQPIMKKARKIQVPEEQKDEKYWSRRYKNNEAAKRSRDARRLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adiponectin Receptor 1 (ADIPOR1) Antibody
abx141611-01 50 µL

Adiponectin Receptor 1 (ADIPOR1) Antibody

Sign In for Pricing
View Details
Adiponectin Receptor 1 (ADIPOR1) Antibody
abx141611-02 100 µL

Adiponectin Receptor 1 (ADIPOR1) Antibody

Sign In for Pricing
View Details
Adiponectin Receptor 1 (ADIPOR1) Antibody
abx141611-03 200 µL

Adiponectin Receptor 1 (ADIPOR1) Antibody

Sign In for Pricing
View Details
E/E073/NT-ALU-148X148/1 Safety & Regulatory Compliance Signs (No Adhesive)
320402 1 Pack (1 Panel (s) x 1 Pack)

E/E073/NT-ALU-148X148/1 Safety & Regulatory Compliance Signs (No Adhesive)

Sign In for Pricing
View Details
Mouse Monoclonal KLHL12/C3IP1 Antibody (OTI4E1) [Alexa Fluor 647]
NBP2-72118AF647 0.1 mL

Mouse Monoclonal KLHL12/C3IP1 Antibody (OTI4E1) [Alexa Fluor 647]

Sign In for Pricing
View Details
OBSL1 (NM_015311) Human Over-expression Lysate
LY414643 100 µg

OBSL1 (NM_015311) Human Over-expression Lysate

Sign In for Pricing
View Details