Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dcaf11 Peptide - C-terminal region

Dcaf11 Peptide - C-terminal region

Product Specifications

Product Name Alternative

0710008A13Rik, C76035, D14Ucla1, Dacf11, GLO14, Wdr23

UniProt

Q9EQQ2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dcaf11 Rabbit Polyclonal Antibody (orb325030) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_075800

Preservative

Lyophilized powder

AA Sequence

WDRRTMREDDPKPVGALAGHQDGITFIDSKGDARYLISNSKDQTIKLWDI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rpsa siRNA Oligos set (Mouse)
42659174 3x 5 nmol

Rpsa siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Recombinant Branchiostoma floridae ATP synthase subunit a (ATP6)
MBS7008459-01 0.02 mg

Recombinant Branchiostoma floridae ATP synthase subunit a (ATP6)

Sign In for Pricing
View Details
Recombinant Branchiostoma floridae ATP synthase subunit a (ATP6)
MBS7008459-02 0.1 mg

Recombinant Branchiostoma floridae ATP synthase subunit a (ATP6)

Sign In for Pricing
View Details
Recombinant Branchiostoma floridae ATP synthase subunit a (ATP6)
MBS7008459-03 5x 0.1 mg

Recombinant Branchiostoma floridae ATP synthase subunit a (ATP6)

Sign In for Pricing
View Details
Boc-L-beta-HMet-OH
sc-293807 1 g

Boc-L-beta-HMet-OH

Sign In for Pricing
View Details
LRSAM1 (NM_001005374) Human Over-expression Lysate
LY423707 100 µg

LRSAM1 (NM_001005374) Human Over-expression Lysate

Sign In for Pricing
View Details