Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dcaf7 Peptide - N-terminal region

Dcaf7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

1700012F10Rik, 2610037L01Rik, C86529, HAN11, Wdr68

UniProt

P61963

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dcaf7 Rabbit Polyclonal Antibody (orb581576) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_082222

Preservative

Lyophilized powder

AA Sequence

SLHGKRKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDE4A Rabbit Polyclonal Antibody
TA379732 100 µL

PDE4A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
UGT1A4 Polyclonal Antibody
E-AB-67676-01 60 µL

UGT1A4 Polyclonal Antibody

Sign In for Pricing
View Details
UGT1A4 Polyclonal Antibody
E-AB-67676-02 120 µL

UGT1A4 Polyclonal Antibody

Sign In for Pricing
View Details
UGT1A4 Polyclonal Antibody
E-AB-67676-03 200 µL

UGT1A4 Polyclonal Antibody

Sign In for Pricing
View Details
Stabilin 2 (STAB2) Mouse Monoclonal Antibody [Clone ID: OTI2A8]
CF806370 100 µg

Stabilin 2 (STAB2) Mouse Monoclonal Antibody [Clone ID: OTI2A8]

Sign In for Pricing
View Details
Glucokinase (GCK) (NM_033508) Human Recombinant Protein
TP318920M 100 µg

Glucokinase (GCK) (NM_033508) Human Recombinant Protein

Sign In for Pricing
View Details