Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCTD Peptide - middle region

DCTD Peptide - middle region

Product Specifications

Product Name Alternative

MGC111062

UniProt

D3DP49

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DCTD Rabbit Polyclonal Antibody (orb581461) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001012750

Preservative

Lyophilized powder

AA Sequence

MSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF190 (MARCH10) Human Over-expression Lysate
orb1373800 20 µg

RNF190 (MARCH10) Human Over-expression Lysate

Sign In for Pricing
View Details
FC1 Antibody
PHY2971A 150 μg

FC1 Antibody

Sign In for Pricing
View Details
Cytokeratin 18 (MaxLight 405) discontinued
C9097-23H-ML405 100 µL

Cytokeratin 18 (MaxLight 405) discontinued

Sign In for Pricing
View Details
Rabbit anti-human Neuroepithelial cell-transforming gene 1 protein polyclonal Antibody
MBS1490345-01 0.05 mg

Rabbit anti-human Neuroepithelial cell-transforming gene 1 protein polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human Neuroepithelial cell-transforming gene 1 protein polyclonal Antibody
MBS1490345-02 0.1 mg

Rabbit anti-human Neuroepithelial cell-transforming gene 1 protein polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human Neuroepithelial cell-transforming gene 1 protein polyclonal Antibody
MBS1490345-03 5x 0.1 mg

Rabbit anti-human Neuroepithelial cell-transforming gene 1 protein polyclonal Antibody

Sign In for Pricing
View Details