Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCTD Peptide - middle region

DCTD Peptide - middle region

Product Specifications

Product Name Alternative

MGC111062

UniProt

D3DP49

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DCTD Rabbit Polyclonal Antibody (orb581461) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001012750

Preservative

Lyophilized powder

AA Sequence

MSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit UNK Antibody
orb1522479-01 10 µL

Rabbit UNK Antibody

Sign In for Pricing
View Details
Rabbit UNK Antibody
orb1522479-02 100 µL

Rabbit UNK Antibody

Sign In for Pricing
View Details
Anti-Human S100P (ABT452) Mouse Monoclonal Antibody
MBS9511329-01 0.05 mL

Anti-Human S100P (ABT452) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Human S100P (ABT452) Mouse Monoclonal Antibody
MBS9511329-02 0.1 mL

Anti-Human S100P (ABT452) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Human S100P (ABT452) Mouse Monoclonal Antibody
MBS9511329-03 0.2 mL

Anti-Human S100P (ABT452) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Human S100P (ABT452) Mouse Monoclonal Antibody
MBS9511329-04 1 mL

Anti-Human S100P (ABT452) Mouse Monoclonal Antibody

Sign In for Pricing
View Details