Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCTN3 Peptide - C-terminal region

DCTN3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DCTN-22, DCTN22, MGC111190

UniProt

O75355

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DCTN3 Rabbit Polyclonal Antibody (orb585339) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001239

Preservative

Lyophilized powder

AA Sequence

ARLQRLAQIHIQQQDQCVEITEESKALLEEYNKTTMLLSKQFVQWDELLC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pentyl Paraben
TRC-P283800-1G 1 g

Pentyl Paraben

Sign In for Pricing
View Details
IL3 Antibody
KC-8316-01 50 μL

IL3 Antibody

Sign In for Pricing
View Details
IL3 Antibody
KC-8316-02 100 µL

IL3 Antibody

Sign In for Pricing
View Details
IL3 Antibody
KC-8316-03 1 mL

IL3 Antibody

Sign In for Pricing
View Details
Sodium Butyrate
TRC-S615175-10G 10 g

Sodium Butyrate

Sign In for Pricing
View Details
Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2616), 1mg/mL
BNUM2616-50 1x 50 µL

Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2616), 1mg/mL

Sign In for Pricing
View Details